Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IMUP protein

This Human IMUP protein spans the amino acid sequence from region 1-85aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IMUP

UniProt

Q9GZP8

Expression Region

1-85aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Isform2 of GST-tag and expression region is 1-85aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-CMV-Anapc5-3xFLAG-CopGFP-Puro Plasmid
PVT69701 2 µg

PLV3-CMV-Anapc5-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
2'-F-m7GMP TEA Salt
2FM7GMP001TEA-10 10 g

2'-F-m7GMP TEA Salt

Sign In for Pricing
View Details
Rosthornin A
orb1710771 1 mg

Rosthornin A

Sign In for Pricing
View Details
Ganoderic acid jb
MEA43068-01 10 mg

Ganoderic acid jb

Sign In for Pricing
View Details
Ganoderic acid jb
MEA43068-02 25 mg

Ganoderic acid jb

Sign In for Pricing
View Details
Ganoderic acid jb
MEA43068-03 50 mg

Ganoderic acid jb

Sign In for Pricing
View Details