Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UBE2V2 protein

This Human UBE2V2 protein spans the amino acid sequence from region 2-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UBE2V2

UniProt

Q15819

Expression Region

2-145aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-145aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SULT2A1 Antibody
orb1324305-01 30 µL

SULT2A1 Antibody

Sign In for Pricing
View Details
SULT2A1 Antibody
orb1324305-02 50 μL

SULT2A1 Antibody

Sign In for Pricing
View Details
SULT2A1 Antibody
orb1324305-03 100 µL

SULT2A1 Antibody

Sign In for Pricing
View Details
Mouse Adenosylhomocysteinase ELISA Kit
orb1660248 96 Tests

Mouse Adenosylhomocysteinase ELISA Kit

Sign In for Pricing
View Details
Pig Thrombospondin 1 (THBS1) ELISA Kit
abx353421-01 96 Tests

Pig Thrombospondin 1 (THBS1) ELISA Kit

Sign In for Pricing
View Details
Pig Thrombospondin 1 (THBS1) ELISA Kit
abx353421-02 5x 96 Tests

Pig Thrombospondin 1 (THBS1) ELISA Kit

Sign In for Pricing
View Details