Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UBE2V2 protein

This Human UBE2V2 protein spans the amino acid sequence from region 2-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UBE2V2

UniProt

Q15819

Expression Region

2-145aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-145aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD17B13 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-17402R-APC-Cy5.5 100 µL

HSD17B13 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
1-Linoleoyl Lysophosphatidic Acid sodium
T83772-01 500 µg

1-Linoleoyl Lysophosphatidic Acid sodium

Sign In for Pricing
View Details
1-Linoleoyl Lysophosphatidic Acid sodium
T83772-02 1 mg

1-Linoleoyl Lysophosphatidic Acid sodium

Sign In for Pricing
View Details
Nitrite Colorimetric Microplate Assay Kit
orb707355 100 assay

Nitrite Colorimetric Microplate Assay Kit

Sign In for Pricing
View Details
Red Arabinan
GW3119-1g 1 g

Red Arabinan

Sign In for Pricing
View Details
Rat Arid3b Pre-designed siRNA Set B
SI200903B 1 Each

Rat Arid3b Pre-designed siRNA Set B

Sign In for Pricing
View Details