Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UBE2D3 protein

This Human UBE2D3 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UBE2D3

UniProt

P61077

Expression Region

1-147aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-147aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tert-Butyl 7-amino-4-azaspiro[2.5]octane-4-carboxylate
QID13641-01 50 mg

Tert-Butyl 7-amino-4-azaspiro[2.5]octane-4-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 7-amino-4-azaspiro[2.5]octane-4-carboxylate
QID13641-02 0.5 g

Tert-Butyl 7-amino-4-azaspiro[2.5]octane-4-carboxylate

Sign In for Pricing
View Details
TBC1D1 Protein Vector (Human) (pPM-C-HA)
46224021 500 ng

TBC1D1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
(S, S, R) -AHPC-C6-NH2
orb3134225-01 10 mg

(S, S, R) -AHPC-C6-NH2

Sign In for Pricing
View Details
(S, S, R) -AHPC-C6-NH2
orb3134225-02 50 mg

(S, S, R) -AHPC-C6-NH2

Sign In for Pricing
View Details
Recombinant Bacillus cereus subsp. cytotoxis UPF0346 protein Bcer98_1690 (Bcer98_1690)
MBS1247514-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus subsp. cytotoxis UPF0346 protein Bcer98_1690 (Bcer98_1690)

Sign In for Pricing
View Details