Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMP4 protein

This Human BMP4 protein spans the amino acid sequence from region 293-408aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BMP4

UniProt

P12644

Expression Region

293-408aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 293-408aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MFRP Antibody
STJ193196 200 µl

Anti-MFRP Antibody

Sign In for Pricing
View Details
UBE2M sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2573406 1.0 µg DNA

UBE2M sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative clathrin assembly protein At5g57200 (At5g57200) , partial
MBS1349793 Inquire

Recombinant Arabidopsis thaliana Putative clathrin assembly protein At5g57200 (At5g57200) , partial

Sign In for Pricing
View Details
SCF (KITLG) (NM_003994) Human Tagged ORF Clone
RC213540 10 µg

SCF (KITLG) (NM_003994) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rgag1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
38892114 3x 1.0 µg

Rgag1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Spetex-2F sgRNA CRISPR Lentivector (Rat) (Target 1)
K6001602 1.0 µg DNA

Spetex-2F sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details