Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Transthyretin protein

This Mouse Transthyretin protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Amyloidosis I protein, ATTR protein, CTS protein, CTS1 protein, HEL111 protein, HsT2651 protein, PALB protein, Prealbumin amyloidosis type I protein, TBPA protein, Transthyretin protein, TTR protein, TTR protein protein

UniProt

P07309

Expression Region

21-147aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 21-147aa of His-SUMO-tag and expression region is 23-147aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AATOM™ 550 acid
70230-AAT 5 mg

AATOM™ 550 acid

Sign In for Pricing
View Details
Dnmt2 (TRDMT1) Mouse Monoclonal Antibody [Clone ID: OTI8H10]
CF811494 100 µg

Dnmt2 (TRDMT1) Mouse Monoclonal Antibody [Clone ID: OTI8H10]

Sign In for Pricing
View Details
CO2 Incubator Air Jacketed BCAJ-8201
BCAJ-8201 1 Unit

CO2 Incubator Air Jacketed BCAJ-8201

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS505967 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
MYBPC3 (NM_000256) Human Recombinant Protein
TP317720L 1 mg

MYBPC3 (NM_000256) Human Recombinant Protein

Sign In for Pricing
View Details
Vmn2r115 Mouse Gene Knockout Kit (CRISPR)
KN519130 1 Kit

Vmn2r115 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details