Human BID protein

Apoptic death agonist protein, BH3 interacting domain death agonist protein, BH3 interacting domain death agonist p11 protein, BH3 interacting domain death agonist p13 protein, BH3 interacting domain death agonist p15 protein, BH3-interacting domain death agonist p11 protein, BID protein, BID isoform ES (1b) protein, BID isoform L (2) protein, BID isoform Si6 protein, Desmocollin type 4 protein, FP497 protein, p11 BID protein, p13 BID protein, p15 BID protein, p22 BID protein

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD