Human BID protein
This Human BID protein spans the amino acid sequence from region 1-195aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Apoptic death agonist protein, BH3 interacting domain death agonist protein, BH3 interacting domain death agonist p11 protein, BH3 interacting domain death agonist p13 protein, BH3 interacting domain death agonist p15 protein, BH3-interacting domain death agonist p11 protein, BID protein, BID isoform ES (1b) protein, BID isoform L (2) protein, BID isoform Si6 protein, Desmocollin type 4 protein, FP497 protein, p11 BID protein, p13 BID protein, p15 BID protein, p22 BID protein
UniProt
P55957
Expression Region
1-195aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
38 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of His-SUMO-tag and expression region is 1-195aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog