Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ASPH protein

This Human ASPH protein spans the amino acid sequence from region 75-270aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASPH

UniProt

Q12797

Expression Region

75-270aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of Isoform 6 of His-SUMO-tag and expression region is 75-270aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Vasoactive Intestinal Peptide ELISA Kit
MBS025730-01 48 Well

Rat Vasoactive Intestinal Peptide ELISA Kit

Sign In for Pricing
View Details
Rat Vasoactive Intestinal Peptide ELISA Kit
MBS025730-02 96 Well

Rat Vasoactive Intestinal Peptide ELISA Kit

Sign In for Pricing
View Details
Rat Vasoactive Intestinal Peptide ELISA Kit
MBS025730-03 5x 96 Well

Rat Vasoactive Intestinal Peptide ELISA Kit

Sign In for Pricing
View Details
Rat Vasoactive Intestinal Peptide ELISA Kit
MBS025730-04 10x 96 Well

Rat Vasoactive Intestinal Peptide ELISA Kit

Sign In for Pricing
View Details
MYEOV2 discontinued
511814 100 µg

MYEOV2 discontinued

Sign In for Pricing
View Details
Mouse Meprin A Subunit Beta (MEP1B) ELISA Kit
abx517953 96 Tests

Mouse Meprin A Subunit Beta (MEP1B) ELISA Kit

Sign In for Pricing
View Details