Human ASPH protein
This Human ASPH protein spans the amino acid sequence from region 75-270aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
ASPH
UniProt
Q12797
Expression Region
75-270aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
38.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial of the full length of Isoform 6 of His-SUMO-tag and expression region is 75-270aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
058473-01 10 µg
Eukaryotic Excitatory Amino Acid Transporter 2 (EAAT2), Recombinant, Human, His-Tag
Sign In for Pricing
View Details 
058473-02 50 µg
Eukaryotic Excitatory Amino Acid Transporter 2 (EAAT2), Recombinant, Human, His-Tag
Sign In for Pricing
View Details 058473-03 100 µg
Eukaryotic Excitatory Amino Acid Transporter 2 (EAAT2), Recombinant, Human, His-Tag
Sign In for Pricing
View Details 058473-04 200 µg
Eukaryotic Excitatory Amino Acid Transporter 2 (EAAT2), Recombinant, Human, His-Tag
Sign In for Pricing
View Details MBS6151954-01 0.1 mL
CREB3L2 (BBF2H7, Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, BBF2 Human Homolog on Chromosome 7, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, MGC131709, MGC71006) (HRP)
Sign In for Pricing
View Details MBS6151954-02 5x 0.1 mL
CREB3L2 (BBF2H7, Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, BBF2 Human Homolog on Chromosome 7, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, MGC131709, MGC71006) (HRP)
Sign In for Pricing
View Details