Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TMLHE protein

This Human TMLHE protein spans the amino acid sequence from region 16-376aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TMLHE

UniProt

Q9NVH6

Expression Region

16-376aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Isoform4 of His-tag and expression region is 16-376aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTYRHFVSGTSIEHRGSLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALG10B (Putative Dol-P-Glc:Glc (2) Man (9) GlcNAc (2) -PP-Dol Alpha-1,2-Glucosyltransferase)
475101 100 µL

ALG10B (Putative Dol-P-Glc:Glc (2) Man (9) GlcNAc (2) -PP-Dol Alpha-1,2-Glucosyltransferase)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Chaperone protein hifB (hifB)
MBS1188511-01 0.02 mg (E-Coli)

Recombinant Haemophilus influenzae Chaperone protein hifB (hifB)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Chaperone protein hifB (hifB)
MBS1188511-02 0.1 mg (E-Coli)

Recombinant Haemophilus influenzae Chaperone protein hifB (hifB)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Chaperone protein hifB (hifB)
MBS1188511-03 0.02 mg (Yeast)

Recombinant Haemophilus influenzae Chaperone protein hifB (hifB)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Chaperone protein hifB (hifB)
MBS1188511-04 0.1 mg (Yeast)

Recombinant Haemophilus influenzae Chaperone protein hifB (hifB)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Chaperone protein hifB (hifB)
MBS1188511-05 0.02 mg (Baculovirus)

Recombinant Haemophilus influenzae Chaperone protein hifB (hifB)

Sign In for Pricing
View Details