Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ARSB protein

This Human ARSB protein spans the amino acid sequence from region 37-533aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ARSB

UniProt

P15848

Expression Region

37-533aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

72 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 37-533aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDE2 CRISPR Activation Plasmid (m)
sc-433283-ACT 20 µg

GDE2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
MPHOSPH8 siRNA (Human)
CRJ0189-01 15 nmol

MPHOSPH8 siRNA (Human)

Sign In for Pricing
View Details
MPHOSPH8 siRNA (Human)
CRJ0189-02 30 nmol

MPHOSPH8 siRNA (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal GRHL1 Antibody [Alexa Fluor 750]
NBP3-21433AF750 0.1 mL

Rabbit Polyclonal GRHL1 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Anti-DCI/ECI1 Antibody Picoband®, Dylight594 Conjugate
PA1763-Dylight594 100 µg

Anti-DCI/ECI1 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SIRPB1 (Signal regulatory protein beta 1) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, PaRoom Temperatureial (30-371aa)
MPX4626K Each

Magic™ Membrane Protein Human SIRPB1 (Signal regulatory protein beta 1) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, PaRoom Temperatureial (30-371aa)

Sign In for Pricing
View Details