Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TMEM25 protein

This Human TMEM25 protein spans the amino acid sequence from region 27-322aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TMEM25

UniProt

Q86YD3

Expression Region

27-322aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Isoform 2 of His-SUMO-tag and expression region is 27-322aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEIWL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin Carboxyl-Terminal Hydrolase 21 (USP21) Antibody
abx031499-01 80 µL

Ubiquitin Carboxyl-Terminal Hydrolase 21 (USP21) Antibody

Sign In for Pricing
View Details
Ubiquitin Carboxyl-Terminal Hydrolase 21 (USP21) Antibody
abx031499-02 400 µL

Ubiquitin Carboxyl-Terminal Hydrolase 21 (USP21) Antibody

Sign In for Pricing
View Details
Avibactam Impurity C
RM-A220303-01 10 mg

Avibactam Impurity C

Sign In for Pricing
View Details
Avibactam Impurity C
RM-A220303-02 25 mg

Avibactam Impurity C

Sign In for Pricing
View Details
Avibactam Impurity C
RM-A220303-03 50 mg

Avibactam Impurity C

Sign In for Pricing
View Details
Avibactam Impurity C
RM-A220303-04 100 mg

Avibactam Impurity C

Sign In for Pricing
View Details