Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TMEM14B protein

This Human TMEM14B protein spans the amino acid sequence from region 1-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TMEM14B

UniProt

Q9NUH8

Expression Region

1-114aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-114aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indole-3-carbinol
GK5424-1g 1 g

Indole-3-carbinol

Sign In for Pricing
View Details
FOXO3 Antibody - N-terminal region : Biotin (ARP38040_P050-Biotin)
ARP38040_P050-Biotin 100 µL

FOXO3 Antibody - N-terminal region : Biotin (ARP38040_P050-Biotin)

Sign In for Pricing
View Details
RGD1562066 3'UTR GFP Stable Cell Line
TU268513 1.0 mL

RGD1562066 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MFRP (Membrane Frizzled-Related Protein, Membrane-type Frizzled-related Protein, C1QTNF5, DKFZp586B0621, FLJ30570, MCOP5, MGC32938 NNO2) (MaxLight 750) discontinued
129613-ML750 100 µL

MFRP (Membrane Frizzled-Related Protein, Membrane-type Frizzled-related Protein, C1QTNF5, DKFZp586B0621, FLJ30570, MCOP5, MGC32938 NNO2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
NTN CRISPR/Cas9 KO Plasmid (h)
sc-408757 20 µg

NTN CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
ARHGAP42 CRISPRa sgRNA lentivector (set of three targets)(Human)
12309121 3x 1.0µg DNA

ARHGAP42 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details