Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Apolipoprotein E protein

This Mouse Apolipoprotein E protein spans the amino acid sequence from region 19-311aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AD2 Proteins, Apo-E Proteins, APOE Proteins, APOE_HUMAN Proteins, APOEA Proteins, Apolipoprotein E Proteins, Apolipoprotein E3 Proteins, ApolipoproteinE Proteins, Apoprotein Proteins, LDLCQ5 Proteins, LPG Proteins

UniProt

P08226

Expression Region

19-311aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 19-311aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAGLN (Transgelin, SM22, SMCC, TAGLN1, WS3-10) (AP)
MBS6449715-01 0.1 mL

TAGLN (Transgelin, SM22, SMCC, TAGLN1, WS3-10) (AP)

Sign In for Pricing
View Details
TAGLN (Transgelin, SM22, SMCC, TAGLN1, WS3-10) (AP)
MBS6449715-02 5x 0.1 mL

TAGLN (Transgelin, SM22, SMCC, TAGLN1, WS3-10) (AP)

Sign In for Pricing
View Details
KEAP1, CT (KEAP1, INRF2, KIAA0132, KLHL19, Kelch-like ECH-associated protein 1, Cytosolic inhibitor of Nrf2, Kelch-like protein 19) (Azide free) (HRP) discontinued
037377-HRP 200 µL

KEAP1, CT (KEAP1, INRF2, KIAA0132, KLHL19, Kelch-like ECH-associated protein 1, Cytosolic inhibitor of Nrf2, Kelch-like protein 19) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Mouse PRF1 (Perforin 1) ELISA Kit
orb2992016-01 48 Tests

Mouse PRF1 (Perforin 1) ELISA Kit

Sign In for Pricing
View Details
Mouse PRF1 (Perforin 1) ELISA Kit
orb2992016-02 96 Tests

Mouse PRF1 (Perforin 1) ELISA Kit

Sign In for Pricing
View Details
Human ADGRA2 qPCR Primer Pair
QH37053S 200 Tests

Human ADGRA2 qPCR Primer Pair

Sign In for Pricing
View Details