Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Apoc3 protein

This Mouse Apoc3 protein spans the amino acid sequence from region 21-99aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apoc3

UniProt

P33622

Expression Region

21-99aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 21-99aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse D630003M21Rik shRNA (UAS) - Lentiviral mouseD630003M21Rik shRNA (UAS, GFP) (25)
GTR15241112 1 Vial

Lentiviral mouse D630003M21Rik shRNA (UAS) - Lentiviral mouseD630003M21Rik shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
SP7 (Sp7 Transcription Factor, MGC126598, OSX, osterix) (MaxLight 550)
252021-ML550 100 µL

SP7 (Sp7 Transcription Factor, MGC126598, OSX, osterix) (MaxLight 550)

Sign In for Pricing
View Details
Rat Selenom Pre-designed siRNA Set B
SI212597B 1 Each

Rat Selenom Pre-designed siRNA Set B

Sign In for Pricing
View Details
IKKb Antibody
R31146 100 µg

IKKb Antibody

Sign In for Pricing
View Details
PPM-18
HY-118160 1 mg

PPM-18

Sign In for Pricing
View Details
P4HB Recombinant Rabbit mAb, RBITC conjugated
orb3164756 100 µL

P4HB Recombinant Rabbit mAb, RBITC conjugated

Sign In for Pricing
View Details