Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AP1S3 protein

This Human AP1S3 protein spans the amino acid sequence from region 1-104aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AP1S3

UniProt

Q96PC3

Expression Region

1-104aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Expression region is 1-104aa and GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (AP) discontinued
C2399-08A-AP 100 µL

CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (AP) discontinued

Sign In for Pricing
View Details
Mouse Chemokine C-X3-C-Motif Receptor 1 (CX3CR1) ELISA Kit
NSL1696m 96 Tests

Mouse Chemokine C-X3-C-Motif Receptor 1 (CX3CR1) ELISA Kit

Sign In for Pricing
View Details
GKN1 Antibody
OACD03863-100UL 100 µL

GKN1 Antibody

Sign In for Pricing
View Details
Atg9a Antibody - C-terminal region : HRP (ARP58930_P050-HRP)
ARP58930_P050-HRP 100 µL

Atg9a Antibody - C-terminal region : HRP (ARP58930_P050-HRP)

Sign In for Pricing
View Details
C2orf76 Polyclonal Antibody, Biotin Conjugated
A64909-100 100 µL

C2orf76 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Recombinant Gloeobacter violaceus Adenylate kinase (adk)
MBS1333742-01 0.02 mg (E-Coli)

Recombinant Gloeobacter violaceus Adenylate kinase (adk)

Sign In for Pricing
View Details