Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AP1S3 protein

This Human AP1S3 protein spans the amino acid sequence from region 1-104aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AP1S3

UniProt

Q96PC3

Expression Region

1-104aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Expression region is 1-104aa and GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTFR1L siRNA (Mouse)
CRM9721-01 15 nmol

MTFR1L siRNA (Mouse)

Sign In for Pricing
View Details
MTFR1L siRNA (Mouse)
CRM9721-02 30 nmol

MTFR1L siRNA (Mouse)

Sign In for Pricing
View Details
Anti-Synaptogyrin 3/SYNGR3 Antibody Picoband® Fluoro550 Conjugated
A14692-2-Fluoro550 100 µg/Vial

Anti-Synaptogyrin 3/SYNGR3 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
FBLN1, CT (FBLN1, Fibulin-1) (MaxLight 405) discontinued
035531-ML405 100 µL

FBLN1, CT (FBLN1, Fibulin-1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
2-Ethoxy-4-aminopyridine ≥95% (NMR)
230293-01 250 mg

2-Ethoxy-4-aminopyridine ≥95% (NMR)

Sign In for Pricing
View Details
2-Ethoxy-4-aminopyridine ≥95% (NMR)
230293-02 1 g

2-Ethoxy-4-aminopyridine ≥95% (NMR)

Sign In for Pricing
View Details