Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AKR1C2 protein

This Human AKR1C2 protein spans the amino acid sequence from region 1-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AKR1C2

UniProt

P52895

Expression Region

1-323aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-323aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF138P1 Human qPCR Primer Pair (NR_001575)
HP219955 200 Reactions

RNF138P1 Human qPCR Primer Pair (NR_001575)

Sign In for Pricing
View Details
Esm1 (NM_023612) Mouse Tagged ORF Clone
MG201704 10 µg

Esm1 (NM_023612) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MCP2 protein
30R-2536 10 ug

MCP2 protein

Sign In for Pricing
View Details
Olr255 AAV Vector (Rat) (CMV)
34262106 1 µg

Olr255 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
OR6C6 ORF Vector (Human) (pORF)
35494011 1.0 µg DNA

OR6C6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
UTY rabbit pAb
ES18945-01 50 µL

UTY rabbit pAb

Sign In for Pricing
View Details