Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AKR1C2 protein

This Human AKR1C2 protein spans the amino acid sequence from region 1-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AKR1C2

UniProt

P52895

Expression Region

1-323aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-323aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMACR (Alpha-methylacyl-CoA Racemase, 2-methylacyl-CoA Racemase) (MaxLight 650)
137535-ML650 100 µL

AMACR (Alpha-methylacyl-CoA Racemase, 2-methylacyl-CoA Racemase) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Polyclonal ABCF3 Antibody
NBP2-92211-0.1mL 0.1 mL

Rabbit Polyclonal ABCF3 Antibody

Sign In for Pricing
View Details
Gm7816 Mouse siRNA Oligo Duplex (Locus ID 665839)
SR413145 1 Kit

Gm7816 Mouse siRNA Oligo Duplex (Locus ID 665839)

Sign In for Pricing
View Details
PAX2 Antibody - middle region : FITC (P100859_P050-FITC)
P100859_P050-FITC 100 µL

PAX2 Antibody - middle region : FITC (P100859_P050-FITC)

Sign In for Pricing
View Details
IRX4 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
25106156 3x 1.0 µg DNA

IRX4 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
CEA antibody
MBS834151-01 1 mg

CEA antibody

Sign In for Pricing
View Details