Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AGRP protein

This Human AGRP protein spans the amino acid sequence from region 21-132aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AGRP

UniProt

O00253

Expression Region

21-132aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 21-132aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Scarf2 shRNA (UAS) - Lentiviral mouseScarf2 shRNA (UAS, GFP) (25)
GTR15164672 1 Vial

Lentiviral mouse Scarf2 shRNA (UAS) - Lentiviral mouseScarf2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
PRDX1 Rabbit Polyclonal Antibody
RA20001-01 50 ul

PRDX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRDX1 Rabbit Polyclonal Antibody
RA20001-02 100 ul

PRDX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Col4a4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3876307 1.0 µg DNA

Col4a4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
STARD3 N-Terminal Like (STARD3NL) Antibody
abx124820-01 20 µL

STARD3 N-Terminal Like (STARD3NL) Antibody

Sign In for Pricing
View Details
STARD3 N-Terminal Like (STARD3NL) Antibody
abx124820-02 100 µL

STARD3 N-Terminal Like (STARD3NL) Antibody

Sign In for Pricing
View Details