Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli add protein

This E. coli add protein spans the amino acid sequence from region 1-333aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Add

UniProt

P22333

Expression Region

1-333aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-333aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIDTTLPLTDIHRHLDGNIRPQTILELGRQYNISLPAQSLETLIPHVQVIANEPDLVSFLTKLDWGVKVLASLDACRRVAFENIEDAARHGLHYVELRFSPGYMAMAHQLPVAGVVEAVIDGVREGCRTFGVQAKLIGIMSRTFGEAACQQELEAFLAHRDQITALDLAGDELGFPGSLFLSHFNRARDAGWHITVHAGEAAGPESIWQAIRELGAERIGHGVKAIEDRALMDFLAEQQIGIESCLTSNIQTSTVAELAAHPLKTFLEHGIRASINTDDPGVQGVDIIHEYTVAAPAAGLSREQIRQAQINGLEMAFLSAEEKRALREKVAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WWTR1 Antibody (C-term)
MBS9214244-01 0.08 mL

WWTR1 Antibody (C-term)

Sign In for Pricing
View Details
WWTR1 Antibody (C-term)
MBS9214244-02 0.4 mL

WWTR1 Antibody (C-term)

Sign In for Pricing
View Details
WWTR1 Antibody (C-term)
MBS9214244-03 5x 0.4 mL

WWTR1 Antibody (C-term)

Sign In for Pricing
View Details
ANKRD40 Human Over-expression Lysate
orb1372431 20 µg

ANKRD40 Human Over-expression Lysate

Sign In for Pricing
View Details
Camel Forkhead Box Protein P1 ELISA Kit
MBS085080-01 48 Well

Camel Forkhead Box Protein P1 ELISA Kit

Sign In for Pricing
View Details
Camel Forkhead Box Protein P1 ELISA Kit
MBS085080-02 96 Well

Camel Forkhead Box Protein P1 ELISA Kit

Sign In for Pricing
View Details