Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat APRIL

A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Rat APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast.

Product Specifications

Source

Yeast

Form

Lyophilized

Molecular Weight

16.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

Applications Notes

The Mouse FGF basic protein can be used in cell culture, as a FGF basic ELISA Standard, and as a Western Blot Control.

AA Sequence

AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYL LYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDI ITVKIPRANAKLSLSPHGTFLGFVKL (146)
More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit
MBS2024617-01 24 Strip Well

Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit

Sign In for Pricing
View Details
Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit
MBS2024617-02 48 Strip Well

Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit

Sign In for Pricing
View Details
Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit
MBS2024617-03 96 Strip Well

Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit

Sign In for Pricing
View Details
Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit
MBS2024617-04 5x 96 Strip Well

Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit

Sign In for Pricing
View Details
Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit
MBS2024617-05 10x 96 Strip Well

Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human DAW1 shRNA (UAS) - Lentiviral human DAW1 shRNA (UAS, RFP) (100)
GTR15132384 1 Vial

Lentiviral human DAW1 shRNA (UAS) - Lentiviral human DAW1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details