Recombinant Rat APRIL
A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Rat APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast.
Product Specifications
Source
Yeast
Form
Lyophilized
Molecular Weight
16.4 kDa
Storage Conditions
-20°C
Notes
For research use only.
Applications Notes
The Mouse FGF basic protein can be used in cell culture, as a FGF basic ELISA Standard, and as a Western Blot Control.
AA Sequence
AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYL LYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDI ITVKIPRANAKLSLSPHGTFLGFVKL (146)
More Discoveries
Explore Other Products
Browse additional items from our catalog
C2411-23C-FITC 100 µL
CD57 (CD57 Antigen, Beta-1,3-glucuronyltransferase 1, B3GAT1, Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1, Glucuronosyltransferase P, GLCATP, GlcAT-P, GlcUATP, GlcUAT-P, HNK1, HNK-1, LEU7, LEU7 Antigen, NK1, NK-1, UDP-GlcUA Glycoprotein beta-1,3-glucuronyltransferase) (FITC) discontinued
Sign In for Pricing
View Details 
NBP2-98120FR 0.1 mL
Rabbit Polyclonal Carbonic Anhydrase X/CA10 Antibody [DyLight 680]
Sign In for Pricing
View Details MBS725610-01 48 Well
Human Complement Component 1 Q Receptor ELISA Kit
Sign In for Pricing
View Details MBS725610-02 96 Well
Human Complement Component 1 Q Receptor ELISA Kit
Sign In for Pricing
View Details