Recombinant Mouse IFN gamma
IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Mouse IFN gamma Recombinant Protein is purified IFN gamma produced in yeast.
Product Specifications
Source
Yeast
Field of Research
Infectious Disease & Virology
Form
Lyophilized
Molecular Weight
15.5 kDa
Storage Conditions
-20°C
Notes
For research use only.
Applications Notes
The Rat APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.
AA Sequence
HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLK DNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLL PESSLRKRKRSRC (133)
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1052943 100 µL
TGF beta Receptor II Rabbit Polyclonal Antibody (Cy5.5)
Sign In for Pricing
View Details 
273362 505 Roll (505 Marker (s) x 1 Roll)
PMF-BASSEPRESSION-GY3-RLL090 Pipe Markers for Steam
Sign In for Pricing
View Details 
90-2238-1 x 96 1x 96 Tests
Human IL-12 (p70) (Interleukin 12, p70) Pre-Coated ELISA Kit
Sign In for Pricing
View Details 125545-APC 100 µL
Cyclophilin E (Cyclophilin 33, CYP33, CYP-33, MGC3736, MGC111222, Peptidyl-Prolyl Cis-Trans Isomerase E, PPIase E, PPIE, Rotamase E, Rotamase-E) (APC)
Sign In for Pricing
View Details 