Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IFN gamma

IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Mouse IFN gamma Recombinant Protein is purified IFN gamma produced in yeast.

Product Specifications

Source

Yeast

Field of Research

Infectious Disease & Virology

Form

Lyophilized

Molecular Weight

15.5 kDa

Storage Conditions

-20°C

Notes

For research use only.

Applications Notes

The Rat APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.

AA Sequence

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLK DNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLL PESSLRKRKRSRC (133)

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1L1 antibody
10R-3279 100 µL

ALDH1L1 antibody

Sign In for Pricing
View Details
Recombinant Bovine Tricarboxylate transport protein, mitochondrial (SLC25A1)
orb2910540-01 20 µg

Recombinant Bovine Tricarboxylate transport protein, mitochondrial (SLC25A1)

Sign In for Pricing
View Details
Recombinant Bovine Tricarboxylate transport protein, mitochondrial (SLC25A1)
orb2910540-02 100 µg

Recombinant Bovine Tricarboxylate transport protein, mitochondrial (SLC25A1)

Sign In for Pricing
View Details
3-Chloro-N, N-dimethylpropan-1-amine hydrochloride
orb2939121-01 100 g

3-Chloro-N, N-dimethylpropan-1-amine hydrochloride

Sign In for Pricing
View Details
3-Chloro-N, N-dimethylpropan-1-amine hydrochloride
orb2939121-02 25 g

3-Chloro-N, N-dimethylpropan-1-amine hydrochloride

Sign In for Pricing
View Details
LEMD2 Antibody - middle region
ARP55791_P050-25UL 25 µL

LEMD2 Antibody - middle region

Sign In for Pricing
View Details