Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-10

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Mouse IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.

Product Specifications

Source

Yeast

Field of Research

Immunology & Inflammation

Form

Lyophilized

Molecular Weight

18.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

Applications Notes

The Mouse IFN gamma protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.

AA Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTERF Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
30875065 1.0 µg DNA

MTERF Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
LAMP1 Antibody
MBS9607686-01 0.1 mL

LAMP1 Antibody

Sign In for Pricing
View Details
LAMP1 Antibody
MBS9607686-02 0.2 mL

LAMP1 Antibody

Sign In for Pricing
View Details
LAMP1 Antibody
MBS9607686-03 5x 0.2 mL

LAMP1 Antibody

Sign In for Pricing
View Details
Goat Medium wave sensitive opsin 1 (OPN1MW) ELISA Kit
GTR10324893 96 Well

Goat Medium wave sensitive opsin 1 (OPN1MW) ELISA Kit

Sign In for Pricing
View Details
4-Bromo-5-chloro-2-fluorophenol
PC56016 1 Each

4-Bromo-5-chloro-2-fluorophenol

Sign In for Pricing
View Details