Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-10

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Mouse IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.

Product Specifications

Source

Yeast

Field of Research

Immunology & Inflammation

Form

Lyophilized

Molecular Weight

18.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

Applications Notes

The Mouse IFN gamma protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.

AA Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Epoxide Hydrolase 2 (EPHX2) ELISA Kit
MBS9921683 Inquire

Rabbit Epoxide Hydrolase 2 (EPHX2) ELISA Kit

Sign In for Pricing
View Details
Mpv17 (NM_008622) Mouse Tagged Lenti ORF Clone
MR201540L3 10 µg

Mpv17 (NM_008622) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
hsa-miR-519b-3p miRNA Antagomir
MNH02911 2x 5.0 nmol

hsa-miR-519b-3p miRNA Antagomir

Sign In for Pricing
View Details
OR6W1P Protein Vector (Human) (pPM-C-His)
PV108365 500 ng

OR6W1P Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
OR1D2, CT (OR1D2, OLFR1, Olfactory receptor 1D2, Olfactory receptor 17-4, Olfactory receptor OR17-6, Olfactory receptor-like protein HGMP07E) (Biotin) discontinued
039330-Biotin 200 µL

OR1D2, CT (OR1D2, OLFR1, Olfactory receptor 1D2, Olfactory receptor 17-4, Olfactory receptor OR17-6, Olfactory receptor-like protein HGMP07E) (Biotin) discontinued

Sign In for Pricing
View Details
Human GNAI1 shRNA Plasmid
abx951841-01 150 µg

Human GNAI1 shRNA Plasmid

Sign In for Pricing
View Details