Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse VEGF-A

VEGF-A is member of the family of vascular endothelial growth factor (VEGF) proteins, which stimulate vasculogenesis and angiogenesis to restore oxygen supply to tissues. VEGF-A is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor (VPF) . Mouse VEGF-A Recombinant Protein is purified vascular endothelial growth factor A produced in yeast.

Product Specifications

Source

Yeast

Field of Research

Cardiovascular Research; Cell Biology

Form

Lyophilized

Molecular Weight

19.3 kDa

Storage Conditions

-20°C

Notes

For research use only.

Applications Notes

The Mouse IL-2 protein can be used in cell culture, as an IL-2 ELISA Standard, and as a Western Blot Control.

AA Sequence

APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCC NDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCS ERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB11B Protein Vector (Human) (pPM-C-HA)
PV056895 500 ng

RAB11B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Hmgn5 AAV siRNA Pooled Vector
23675164 1.0 µg

Hmgn5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
AMDHD2 (NM_015944) Human Over-expression Lysate
LC414297 20 µg

AMDHD2 (NM_015944) Human Over-expression Lysate

Sign In for Pricing
View Details
GFI1 Antibody - N-terminal region : FITC (ARP32557_P050-FITC)
ARP32557_P050-FITC 100 µL

GFI1 Antibody - N-terminal region : FITC (ARP32557_P050-FITC)

Sign In for Pricing
View Details
Eno3 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4753203 1.0 µg DNA

Eno3 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse Pced1b (NM_172293) AAV Particle
MR206902A1V 250 µL

Mouse Pced1b (NM_172293) AAV Particle

Sign In for Pricing
View Details