Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse VEGF-A

VEGF-A is member of the family of vascular endothelial growth factor (VEGF) proteins, which stimulate vasculogenesis and angiogenesis to restore oxygen supply to tissues. VEGF-A is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor (VPF) . Mouse VEGF-A Recombinant Protein is purified vascular endothelial growth factor A produced in yeast.

Product Specifications

Source

Yeast

Field of Research

Cardiovascular Research; Cell Biology

Form

Lyophilized

Molecular Weight

19.3 kDa

Storage Conditions

-20°C

Notes

For research use only.

Applications Notes

The Mouse IL-2 protein can be used in cell culture, as an IL-2 ELISA Standard, and as a Western Blot Control.

AA Sequence

APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCC NDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCS ERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM63C sgRNA CRISPR Lentivector (Human) (Target 2)
K2392203 1.0 µg DNA

TMEM63C sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-alpha 1 Catenin/CTNNA1 Antibody Picoband® Fluoro647 Conjugated
PB9137-Fluoro647 100 µg/Vial

Anti-alpha 1 Catenin/CTNNA1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Bmf sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3900203 1.0 µg DNA

Bmf sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
RPL5 Antibody - Biotin Conjugated
OACA00936-100UG 100 µg

RPL5 Antibody - Biotin Conjugated

Sign In for Pricing
View Details
PODXL sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1679407 1.0 µg DNA

PODXL sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal EEF1D Antibody
NBP2-56820 100 µL

Rabbit Polyclonal EEF1D Antibody

Sign In for Pricing
View Details