Recombinant Mouse APRIL
A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Mouse APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast.
Product Specifications
Source
Yeast
Form
Lyophilized
Molecular Weight
16.4 kDa
Storage Conditions
-20°C
Notes
For research use only.
Applications Notes
The Mouse VEGF-A protein can be used in cell culture, as a VEGF-A ELISA Standard, and as a Western Blot Control.
AA Sequence
AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYL LYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDI ITVKIPRANAKLSLSPHGTFLGFVKL (146)
More Discoveries
Explore Other Products
Browse additional items from our catalog
C2272-71J-HRP 100 µL
CD21 (CD21 Antigen, Complement Component (3d/Epstein Barr Virus) Receptor 2, Complement Receptor 2, Complement Receptor Type 2 Precursor, CR2, Complement C3d Receptor, C3DR, Epstein-Barr Virus Receptor, EBV Receptor, SLEB9) (HRP)
Sign In for Pricing
View Details 
OR33389-01 500 mg
2- (Benzylamino) -3-chloro-1,4-dihydronaphthalene-1,4-dione
Sign In for Pricing
View Details OR33389-02 1 g
2- (Benzylamino) -3-chloro-1,4-dihydronaphthalene-1,4-dione
Sign In for Pricing
View Details