Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-1 beta

IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE) . This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.

Product Specifications

Source

Yeast

Field of Research

Immunology & Inflammation

Form

Lyophilized

Molecular Weight

17.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

Applications Notes

The Mouse APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.

AA Sequence

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORD1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV721602 1.0 µg DNA

CORD1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
NKX28 Conjugated Antibody
MBS9445897-01 0.1 mL (Biotin)

NKX28 Conjugated Antibody

Sign In for Pricing
View Details
NKX28 Conjugated Antibody
MBS9445897-02 0.1 mL (AF350)

NKX28 Conjugated Antibody

Sign In for Pricing
View Details
NKX28 Conjugated Antibody
MBS9445897-03 0.1 mL (AF405)

NKX28 Conjugated Antibody

Sign In for Pricing
View Details
NKX28 Conjugated Antibody
MBS9445897-04 0.1 mL (AF488)

NKX28 Conjugated Antibody

Sign In for Pricing
View Details
NKX28 Conjugated Antibody
MBS9445897-05 0.1 mL (AF555)

NKX28 Conjugated Antibody

Sign In for Pricing
View Details