IFN-omega 1, Human
IFN-omega 1 Protein, Human has antiviral, anti-proliferation, and antitumor activities that are similar to those of IFN-α.
Product Specifications
Product Name Alternative
IFN-omega 1 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Applications
Cancer-programmed cell death
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-omega-protein-human.html
Purity
97.00
Smiles
CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS
Molecular Formula
3467 (Gene_ID) P05000 (C24-S195) (Accession)
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Flores, et al. Human interferon omega (omega) binds to the alpha/beta receptor. J Biol Chem. 1991 Oct 25;266 (30) :19875-7.|[2]Hagelstein J, et al. Antiviral potential of interferon-omega on hepatitis B virus replication in human hepatoma cells. Arzneimittelforschung. 1998 Mar;48 (3) :343-7.|[3]Li SF, et al. Interferon-omega: Current status in clinical applications. Int Immunopharmacol. 2017 Nov;52:253-260.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740029-100 1x 100 µL
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402899-100 1x 100 µL
Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470827-100 1x 100 µL
Involucrin (IVRN/827), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details