SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag
SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD.
Product Specifications
Product Name Alternative
SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP8, Nonstructural Protein 8
Reactivity
Mouse
Source
E. coli
Field of Research
Infectious Disease & Virology
Endotoxin
Less than 1 EU/μg protein as determined by LAL method.
Form
Lyophilized
Molecular Weight
22.7KD
Storage Conditions
The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Notes
For research use only.
Preservative
Lyophilized from sterile 20mM PB, 150mM NaCl, pH 7.3-7.4, 10% glycerol and 4% trehalose
AA Sequence
AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940096-500 1x 500 µL
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470994-500 1x 500 µL
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680525-100 1x 100 µL
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882003-500 1x 500 µL
CD8b, Mouse (H35-17.2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details