Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1), partial

Product Specifications

Product Name Alternative

CCP module-containing protein 22; Polydom; Selectin-like osteoblast-derived protein; SEL-OB; Serologically defined breast cancer antigen NY-BR-38

Abbreviation

Recombinant Human SVEP1 protein, partial

Gene Name

SVEP1

UniProt

Q4LDE5

Expression Region

736-827aa

Organism

Homo sapiens (Human)

Target Sequence

GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May play a role in the cell attachment process.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tmem91 shRNA (UAS) - Lentiviral mouse Tmem91 shRNA (UAS, iRFP) (100)
GTR15208971 1 Vial

Lentiviral mouse Tmem91 shRNA (UAS) - Lentiviral mouse Tmem91 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CRMP2 (DPYSL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D7]
TA811601BM 100 µL

CRMP2 (DPYSL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D7]

Sign In for Pricing
View Details
Anapc13 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4734704 1.0 µg DNA

Anapc13 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
GJA8 (NM_005267) Human Mass Spec Standard
PH313469 10 µg

GJA8 (NM_005267) Human Mass Spec Standard

Sign In for Pricing
View Details
GFI1B Peptide-C-terminal region
MBS3249469-01 0.1 mg

GFI1B Peptide-C-terminal region

Sign In for Pricing
View Details
GFI1B Peptide-C-terminal region
MBS3249469-02 5x 0.1 mg

GFI1B Peptide-C-terminal region

Sign In for Pricing
View Details