Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL3, Mouse (His, solution)

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is involved in the regulation of cellular processes and protein degradation. It is particularly expressed in the testes and plays a vital role in spermatogenesis. UCHL3 Protein's significance in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Mouse (His, solution) is the recombinant mouse-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

UCHL3 Protein, Mouse (His, solution), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uchl3-protein-mouse-his-solution.html

Purity

97.00

Smiles

EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Formula

50933 (Gene_ID) Q9JKB1 (E2-A230) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TERF1, Control Peptide (Telomeric Repeat-binding Factor 1, NIMA-interacting Protein 2, TTAGGG Repeat-binding Factor 1, Telomeric Protein Pin2/TRF1, PIN2, TRBF1, TRF, TRF1)
148589 100 µg

TERF1, Control Peptide (Telomeric Repeat-binding Factor 1, NIMA-interacting Protein 2, TTAGGG Repeat-binding Factor 1, Telomeric Protein Pin2/TRF1, PIN2, TRBF1, TRF, TRF1)

Sign In for Pricing
View Details
Recombinant Human CD96 Protein, C-mFc
EHE25701 100 μg

Recombinant Human CD96 Protein, C-mFc

Sign In for Pricing
View Details
Human Anti-IL6 autoantibody ELISA Kit
AE62569HU-01 48 Tests

Human Anti-IL6 autoantibody ELISA Kit

Sign In for Pricing
View Details
Human Anti-IL6 autoantibody ELISA Kit
AE62569HU-02 96 Tests

Human Anti-IL6 autoantibody ELISA Kit

Sign In for Pricing
View Details
Anti-NBAS Antibody
MBS8292157-01 0.03 mL

Anti-NBAS Antibody

Sign In for Pricing
View Details
Anti-NBAS Antibody
MBS8292157-02 0.05 mL

Anti-NBAS Antibody

Sign In for Pricing
View Details