Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL3, Mouse (His, solution)

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is involved in the regulation of cellular processes and protein degradation. It is particularly expressed in the testes and plays a vital role in spermatogenesis. UCHL3 Protein's significance in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Mouse (His, solution) is the recombinant mouse-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

UCHL3 Protein, Mouse (His, solution), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uchl3-protein-mouse-his-solution.html

Purity

97.00

Smiles

EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Formula

50933 (Gene_ID) Q9JKB1 (E2-A230) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ZAP70 Antibody
CQA9283-01 30 µL

Anti-ZAP70 Antibody

Sign In for Pricing
View Details
Anti-ZAP70 Antibody
CQA9283-02 50 μL

Anti-ZAP70 Antibody

Sign In for Pricing
View Details
Anti-ZAP70 Antibody
CQA9283-03 100 µL

Anti-ZAP70 Antibody

Sign In for Pricing
View Details
Anti-ZAP70 Antibody
CQA9283-04 200 µL

Anti-ZAP70 Antibody

Sign In for Pricing
View Details
RGS20 Antibody
orb1255966 100 µL

RGS20 Antibody

Sign In for Pricing
View Details
3- (1,1-dioxo-1,2-thiazolidin-2-yl) propan-1-amine
DWB06463-01 50 mg

3- (1,1-dioxo-1,2-thiazolidin-2-yl) propan-1-amine

Sign In for Pricing
View Details