CDKN2C, Human (His)
The CDKN2C protein (also known as p18) interacts strongly with CDK6 and weakly with CDK4. Its functional effects inhibit cell growth and proliferation and are significantly related to the presence of endogenous retinoblastoma protein RB. CDKN2C Protein, Human (His) is the recombinant human-derived CDKN2C protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
CDKN2C Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cdkn2c-protein-human-his.html
Purity
95.0
Smiles
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Molecular Formula
1031 (Gene_ID) P42773 (M1-Q168) (Accession)
Molecular Weight
Approximately 17.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AK0085-100T-48S 100 Tests - 48 Samples
1,4-β-D-Glucan Cellobilhydrolase (C1) Activity Assay Kit
Sign In for Pricing
View Details ARP66637_P050-Biotin 100 µL
PLEKHA3 Antibody - N-terminal region : Biotin (ARP66637_P050-Biotin)
Sign In for Pricing
View Details 
MBS1099865-01 0.02 mg (E-Coli)
Recombinant Staphylococcus simulans Replication and maintenance protein (repL)
Sign In for Pricing
View Details MBS1099865-02 0.1 mg (E-Coli)
Recombinant Staphylococcus simulans Replication and maintenance protein (repL)
Sign In for Pricing
View Details MBS1099865-03 0.02 mg (Yeast)
Recombinant Staphylococcus simulans Replication and maintenance protein (repL)
Sign In for Pricing
View Details