Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transforming growth factor beta-2 (TGFB2), partial

Product Specifications

Product Name Alternative

(Milk growth factor) (MGF) (LAP) (TGF-beta-2)

Abbreviation

Recombinant Bovine TGFB2 protein, partial

Gene Name

TGFB2

UniProt

P21214

Expression Region

303-414aa

Organism

Bos taurus (Bovine)

Target Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

[Transforming growth factor beta-2 proprotein]: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-2 (TGF-beta-2) chains, which constitute the regulatory and active subunit of TGF-beta-2, respectively. ; [Latency-associated peptide]: Required to maintain the Transforming growth factor beta-2 (TGF-beta-2) chain in a latent state during storage in extracellular matrix. Associates non-covalently with TGF-beta-2 and regulates its activation via interaction with 'milieu molecules', such as LTBP1 and LRRC32/GARP, that control activation of TGF-beta-2. ; [Transforming growth factor beta-2]: Multifunctional protein that regulates various processes such as angiogenesis and heart development. Activation into mature form follows different steps: following cleavage of the proprotein in the Golgi apparatus, Latency-associated peptide (LAP) and Transforming growth factor beta-2 (TGF-beta-2) chains remain non-covalently linked rendering TGF-beta-2 inactive during storage in extracellular matrix. At the same time, LAP chain interacts with 'milieu molecules', such as LTBP1 and LRRC32/GARP, that control activation of TGF-beta-2 and maintain it in a latent state during storage in extracellular milieus. Once activated following release of LAP, TGF-beta-2 acts by binding to TGF-beta receptors (TGFBR1 and TGFBR2), which transduce signal.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.2 kDa

References & Citations

"The genome sequence of taurine cattle: a window to ruminant biology and evolution." The bovine genome sequencing and analysis consortium Science 324:522-528 (2009) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD45 Monoclonal Antibody, PerCP Conjugated
bsm-33052M-PerCP-01 20 µL

CD45 Monoclonal Antibody, PerCP Conjugated

Ask
View Details
CD45 Monoclonal Antibody, PerCP Conjugated
bsm-33052M-PerCP-02 100 µL

CD45 Monoclonal Antibody, PerCP Conjugated

Ask
View Details
Rab3A+Rab3B+Rab3C+Rab3D Antibody, Cy5.5 Conjugated
bs-6180R-Cy5.5 100 µL

Rab3A+Rab3B+Rab3C+Rab3D Antibody, Cy5.5 Conjugated

Ask
View Details
GRIN2C Polyclonal Antibody
RD76385A-01 20 µL

GRIN2C Polyclonal Antibody

Ask
View Details
GRIN2C Polyclonal Antibody
RD76385A-02 60 μL

GRIN2C Polyclonal Antibody

Ask
View Details
GRIN2C Polyclonal Antibody
RD76385A-03 120 μL

GRIN2C Polyclonal Antibody

Ask
View Details