Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL13 protein (Active)

This Human CCL13 protein (Active) spans the amino acid sequence from region 24-98aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-C motif chemokine 13 protein, CCL13 protein, CCL 13 protein, CCL13_HUMAN protein, Chemokine (C C motif) ligand 13 protein, CK beta 10 protein, CKb10 protein, MCP4 protein, MCP 4 protein, MCP-4 protein, Monocyte chemotactic protein 4 protein, NCC 1 protein, NCC-1 protein, NCC1 protein, New CC chemokine 1 protein, SCYA13 protein, SCYL1 protein, short chain protein, Small-inducible cytokine A13 protein

UniProt

Q99616

Expression Region

24-98aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CBX1 Protein, N-His
E55P4680 50 µg

Recombinant Human CBX1 Protein, N-His

Sign In for Pricing
View Details
LK-ELEC-PAD-RD-FR Lockout Tagout Kits
196229 1 Kit (1 Kit x 1 Kit)

LK-ELEC-PAD-RD-FR Lockout Tagout Kits

Sign In for Pricing
View Details
Zfp9 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
51172154 3x 1.0 µg DNA

Zfp9 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
ICAM4 (NM_001544) Human Over-expression Lysate
LS003386-20ug 20 µg

ICAM4 (NM_001544) Human Over-expression Lysate

Sign In for Pricing
View Details
Fruit fly RanBPM Rabbit Polyclonal Antibody (HRP)
orb2572845 200 µL

Fruit fly RanBPM Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
GSK-J4 10mg
A12732-10 10 mg

GSK-J4 10mg

Sign In for Pricing
View Details