Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human X3CL1 protein (Active)

This Human X3CL1 protein (Active) spans the amino acid sequence from region 25-100aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-X3-C motif chemokine 1, Neurotactin, Small-inducible cytokine D1,

UniProt

P78423

Expression Region

25-100aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 5.0-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse ADH1 shRNA Plasmid
abx969050-01 150 µg

Mouse ADH1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse ADH1 shRNA Plasmid
abx969050-02 300 µg

Mouse ADH1 shRNA Plasmid

Sign In for Pricing
View Details
ANKRD13A Polyclonal Antibody, HRP Conjugated
bs-7963R-HRP 100 µL

ANKRD13A Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Rabbit Anti-Human Hepassocin Polyclonal Antibody
PA83442HU-01 50 µg

Rabbit Anti-Human Hepassocin Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Hepassocin Polyclonal Antibody
PA83442HU-02 100 µg

Rabbit Anti-Human Hepassocin Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Hepassocin Polyclonal Antibody
PA83442HU-03 500 µg

Rabbit Anti-Human Hepassocin Polyclonal Antibody

Sign In for Pricing
View Details