Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL10 protein (Active)

This Mouse IL10 protein (Active) spans the amino acid sequence from region 19-178aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-10, CSIF

UniProt

P18893

Expression Region

19-178aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC/9-2 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 6 IU/mg.

Form

Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRUNE2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
37880061 1.0 µg DNA

PRUNE2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Polyclonal IZUMO1 Antibody [Alexa Fluor 700]
NBP3-00139AF700 0.1 mL

Rabbit Polyclonal IZUMO1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Rat FASL ELISA Kit PicoKine®, Carrier-free
EK1110-carrier-free 96 Well With Removable Strips

Rat FASL ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
Anti-IAV Reference Antibody
MBS9247758-01 0.1 mg

Anti-IAV Reference Antibody

Sign In for Pricing
View Details
Anti-IAV Reference Antibody
MBS9247758-02 5x 0.1 mg

Anti-IAV Reference Antibody

Sign In for Pricing
View Details
Rat Neonatal Lung Fibroblasts
cAP-r0008Lung 1 Frozen Vial

Rat Neonatal Lung Fibroblasts

Sign In for Pricing
View Details