Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey IL16 protein (Active)

This Monkey IL16 protein (Active) spans the amino acid sequence from region 510-630aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-16, LCF, ]

UniProt

O62675

Expression Region

510-630aa

Tag

Tag-Free

Source

E.Coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral T lymphocytes is in a concentration range of 1.0-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

12.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

SAASASAASDVSVESSAEATVYTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETIQPGDEILQLAGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQPKETTAAADS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse FAAH (Fatty Acid Amide Hydrolase) ELISA Kit
EK248361 96 Well

Mouse FAAH (Fatty Acid Amide Hydrolase) ELISA Kit

Sign In for Pricing
View Details
Galectin 1/LGALS1 polyclonal antibody
orb646786-01 50 μL

Galectin 1/LGALS1 polyclonal antibody

Sign In for Pricing
View Details
Galectin 1/LGALS1 polyclonal antibody
orb646786-02 100 µL

Galectin 1/LGALS1 polyclonal antibody

Sign In for Pricing
View Details
Galectin 1/LGALS1 polyclonal antibody
orb646786-03 200 µL

Galectin 1/LGALS1 polyclonal antibody

Sign In for Pricing
View Details
DDX52 Antibody
8C17865-AAT 50 µg

DDX52 Antibody

Sign In for Pricing
View Details
TIMP4 (NM_003256) Human Tagged ORF Clone Lentiviral Particle
RC203772L4V 200 µL

TIMP4 (NM_003256) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details