Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL36B protein (Active)

This Human IL36B protein (Active) spans the amino acid sequence from region 1-157aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FIL1 eta, IL-1 eta, Interleukin-1 family member 8, IL-1F8, Interleukin-1 homolog 2

UniProt

Q9NZH7

Expression Region

1-157aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The specific activity is determined by its binding ability in a functional ELISA. Immobilized rHuIL-36β at 1 μg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 μg/mL.

Form

Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDKRB1 Peptide - C-terminal region
MBS3241571-01 0.1 mg

BDKRB1 Peptide - C-terminal region

Sign In for Pricing
View Details
BDKRB1 Peptide - C-terminal region
MBS3241571-02 5x 0.1 mg

BDKRB1 Peptide - C-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal ST3GAL6 Antibody [Alexa Fluor 350]
NBP1-77353AF350 0.1 mL

Rabbit Polyclonal ST3GAL6 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Anti-RSRC2 Antibody Picoband® (Dylight488 Conjugate)
A13417-1-Dylight488 100 µg

Anti-RSRC2 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
MIR876 ORF Vector (Human) (pORF)
ORF025042 1.0 µg DNA

MIR876 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
MGME1 Protein Lysate
OCOA02962-20UG 20 µg

MGME1 Protein Lysate

Sign In for Pricing
View Details