Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LDHC protein

This Human LDHC protein spans the amino acid sequence from region 2-332aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 32 Short name, CT32 LDH testis subunit LDH-X

UniProt

P07864

Expression Region

2-332aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of his-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAA4 Protein Vector (Mouse) (pPM-C-His)
PV226497 500 ng

SAA4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
PRIM1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
37616111 3x 1.0 µg

PRIM1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
NRBF2 Mouse Monoclonal Antibody [Clone ID: OTI1D4]
CF803853 100 µg

NRBF2 Mouse Monoclonal Antibody [Clone ID: OTI1D4]

Sign In for Pricing
View Details
Recombinant Exiguobacterium sp. Non-canonical purine NTP pyrophosphatase (EAT1b_2634)
MBS1147980-01 0.02 mg (E-Coli)

Recombinant Exiguobacterium sp. Non-canonical purine NTP pyrophosphatase (EAT1b_2634)

Sign In for Pricing
View Details
Recombinant Exiguobacterium sp. Non-canonical purine NTP pyrophosphatase (EAT1b_2634)
MBS1147980-02 0.1 mg (E-Coli)

Recombinant Exiguobacterium sp. Non-canonical purine NTP pyrophosphatase (EAT1b_2634)

Sign In for Pricing
View Details
Recombinant Exiguobacterium sp. Non-canonical purine NTP pyrophosphatase (EAT1b_2634)
MBS1147980-03 0.02 mg (Yeast)

Recombinant Exiguobacterium sp. Non-canonical purine NTP pyrophosphatase (EAT1b_2634)

Sign In for Pricing
View Details