Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LDHC protein

This Human LDHC protein spans the amino acid sequence from region 2-332aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 32 Short name, CT32 LDH testis subunit LDH-X

UniProt

P07864

Expression Region

2-332aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of his-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Orexin (HCRT) ELISA Kit
abx256346 96 Well

Rat Orexin (HCRT) ELISA Kit

Sign In for Pricing
View Details
Human Transient Receptor Potential Cation Channel Subfamily A Member 1 ELISA Kit
MBS3804861-01 48 Well

Human Transient Receptor Potential Cation Channel Subfamily A Member 1 ELISA Kit

Sign In for Pricing
View Details
Human Transient Receptor Potential Cation Channel Subfamily A Member 1 ELISA Kit
MBS3804861-02 96 Well

Human Transient Receptor Potential Cation Channel Subfamily A Member 1 ELISA Kit

Sign In for Pricing
View Details
Human Transient Receptor Potential Cation Channel Subfamily A Member 1 ELISA Kit
MBS3804861-03 5x 96 Well

Human Transient Receptor Potential Cation Channel Subfamily A Member 1 ELISA Kit

Sign In for Pricing
View Details
Human Transient Receptor Potential Cation Channel Subfamily A Member 1 ELISA Kit
MBS3804861-04 10x 96 Well

Human Transient Receptor Potential Cation Channel Subfamily A Member 1 ELISA Kit

Sign In for Pricing
View Details
Human rheumatoid factor,RF antibody,IgG ELISA KIT
JOT-EKD0298Hu 96 wells

Human rheumatoid factor,RF antibody,IgG ELISA KIT

Sign In for Pricing
View Details