Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fcgr3 protein

This Mouse Fcgr3 protein spans the amino acid sequence from region 31-215aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fc-gamma RIII Short name, FcRIII CD_antigen, CD16

UniProt

P08508

Expression Region

31-215aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of HIS-tag and expression region is 28.55kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (Membrane Metalloendopeptidase) (MME/1893), Biotin conjugate, 0.1mg/mL
BNCB1893-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Amino-5-naphthol-7-sulfonic Acid
TRC-A618693-5G 5 g

2-Amino-5-naphthol-7-sulfonic Acid

Sign In for Pricing
View Details
6-Iodo Diosmin
TRC-I705850-1MG 1 mg

6-Iodo Diosmin

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Spike RBD Antibody, Mouse IgG1 (5C5C10) (BQ.1.1/Omicron Specific)
SPD-Y170-100ug 100 µg

Anti-SARS-CoV-2 Spike RBD Antibody, Mouse IgG1 (5C5C10) (BQ.1.1/Omicron Specific)

Sign In for Pricing
View Details
PKC epsilon (PRKCE) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B4]
TA502417BM 100 µL

PKC epsilon (PRKCE) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B4]

Sign In for Pricing
View Details
Hras1 (BC011083) Mouse Tagged ORF Clone
MG200555 10 µg

Hras1 (BC011083) Mouse Tagged ORF Clone

Sign In for Pricing
View Details