Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fcgr3 protein

This Mouse Fcgr3 protein spans the amino acid sequence from region 31-215aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fc-gamma RIII Short name, FcRIII CD_antigen, CD16

UniProt

P08508

Expression Region

31-215aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of HIS-tag and expression region is 28.55kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNA18SN5 Human qPCR Primer Pair (NR_003286)
HP220445 200 Reactions

RNA18SN5 Human qPCR Primer Pair (NR_003286)

Sign In for Pricing
View Details
PE Anti-Human CD305 Antibody[NKTA255]
AN00330D-01 20 Tests

PE Anti-Human CD305 Antibody[NKTA255]

Sign In for Pricing
View Details
PE Anti-Human CD305 Antibody[NKTA255]
AN00330D-02 100 Tests

PE Anti-Human CD305 Antibody[NKTA255]

Sign In for Pricing
View Details
PE Anti-Human CD305 Antibody[NKTA255]
AN00330D-03 2x 100 Tests

PE Anti-Human CD305 Antibody[NKTA255]

Sign In for Pricing
View Details
Recombinant Human TNFRSF19/TROY Protein (Fc Tag)
PKSH030639-01 100 µg

Recombinant Human TNFRSF19/TROY Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human TNFRSF19/TROY Protein (Fc Tag)
PKSH030639-02 1 mg

Recombinant Human TNFRSF19/TROY Protein (Fc Tag)

Sign In for Pricing
View Details