Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FNDC5 protein

This Human FNDC5 protein spans the amino acid sequence from region 32-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibronectin type III repeat-containing protein 2

UniProt

Q8NAU1

Expression Region

32-143aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)
MBS2035448-01 0.1 mL

FITC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)
MBS2035448-02 0.2 mL

FITC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)
MBS2035448-03 0.5 mL

FITC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)
MBS2035448-04 1 mL

FITC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)
MBS2035448-05 5 mL

FITC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)
MBS2035448-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details