Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial rnfH protein

This Bacterial rnfH protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RnfH, CbuG_0706, Protein RnfH

UniProt

B6IZH9

Expression Region

1-101aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Coxiella burnetii (strain CbuG_Q212) (Coxiella burnetii (strain Q212) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MISIIIAYATPEKQVEIPLTVEESCTLVVAVKRSGILQQFPEINLSQAIVGIHNKRTALDAGLRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRMVRGEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ER780 Anti-Mouse IgD Antibody [11-26c.2a]
MBS2569722-01 0.025 mg

ER780 Anti-Mouse IgD Antibody [11-26c.2a]

Sign In for Pricing
View Details
ER780 Anti-Mouse IgD Antibody [11-26c.2a]
MBS2569722-02 0.1 mg

ER780 Anti-Mouse IgD Antibody [11-26c.2a]

Sign In for Pricing
View Details
ER780 Anti-Mouse IgD Antibody [11-26c.2a]
MBS2569722-03 5x 0.1 mg

ER780 Anti-Mouse IgD Antibody [11-26c.2a]

Sign In for Pricing
View Details
ZMYM3 Polyclonal Conjugated Antibody
orb1628362 100 µL

ZMYM3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
GRK5 (G-Protein Coupled Receptor Kinase 5, G-Protein-coupled Receptor Kinase GRK5, GPRK5, FLJ39780) (APC)
127550-APC 100 µL

GRK5 (G-Protein Coupled Receptor Kinase 5, G-Protein-coupled Receptor Kinase GRK5, GPRK5, FLJ39780) (APC)

Sign In for Pricing
View Details
HD (Huntingtin, HD, IT15) (Biotin)
246958-Biotin 100 µL

HD (Huntingtin, HD, IT15) (Biotin)

Sign In for Pricing
View Details